SARS-CoV-2 рекомбинантный белок RPS-SARSCOV2-264-680aa, AURON ARTscience

 
 

Цена по запросу

SARSCoV-2 (2019-nCoV) 264-680aa фрагмент спайкового белка (S-белка), рекомбинант E.coli, с присоединенной  His-меткой на N-конце.

Спайковый белок (S-белок) обеспечивает связывание рецептора и слияние мембран. S-белок содержит две субъединицы, S1 и S2. Субъединица S1 содержит рецептор-связывающий домен (RBD), который отвечает за распознавание и связывание с рецептором клеточной поверхности. Некоторые авторы показали, что оптимизированный ИФА против шиповидного S-белка SARS-CoV-2 является чувствительным и специфичным (Freeman et al. 2020).

Описание

SARS-CoV-2 recombinant proteins / SARS-CoV-2 рекомбинантные белки

Оценка количества антител в плазме крови дополняет РНК-тесты и улучшает понимание течения заболевания.  Разработаны тесты, выявляющие антитела к белку нуклеокапсида вируса (N) и/или к спайк-белку (S), на основе иммуноферментного анализа (ИФА), иммунофлуоресценции, иммунохроматографического анализа.

Нейтрализующие антитела, нацеленные на спайк-белки (S) и нуклеокапсид (N) нового коронавируса SARS-CoV-2, образуются уже на 9-й день после инфицирования.  Показано, что у людей с ослабленным иммунитетом антитела на оба белка появлялись в детектируемых количествах позже.

 

RPS-SARSCOV2-264-680aa, AURON ARTscience

SARS-CoV-2 (2019-nCoV) 264-680aa fragment of Spike Protein, E.coli Recombinant, fused to His tag at N-terminal

 

The spike protein (S-protein) mediates receptor binding and membrane fusion. Spike protein contains two subunits, S1 and S2. S1 contains a receptor binding domain (RBD), which is responsible for recognizing and binding with the cell surface receptor. Some authors showed that optimized an ELISA against SARS-CoV-2 spike protein is sensitive and specific (Freeman et al. 2020).

 

Protein S 264-680 aa sequence:

MGSSHHHHHHSSGLVPRGSHMAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNS

 

Regulatory status: RUO (Research Use Only)

Type: Recombinant protein

Source: E. coli

Purity: Greater than 95.0% as determined by HPLC

Form: Dry (lyophilized)

Size: 0.1 mg, 0.5 mg, 1 mg

 

REFERENCES:

Freeman B, Lester S, Mills L, Rasheed MAU, Moye S, Abiona O, Hutchinson GB, Morales-Betoulle M, Krapinunaya I, Gibbons A, Chiang CF, Cannon D, Klena J, Johnson JA, Owen SM, Graham BS, Corbett KS, Thornburg NJ. Validation of a SARS-CoV-2 spike protein ELISA for use in contact investigations and serosurveillance. Version 2. bioRxiv. 2020 Apr

 

SARSCoV-2 (2019-nCoV) 264-680aa фрагмент спайкового белка (S-белка), рекомбинант E.coli, с присоединенной  His-меткой на N-конце.

Спайковый белок (S-белок) обеспечивает связывание рецептора и слияние мембран. S-белок содержит две субъединицы, S1 и S2. Субъединица S1 содержит рецептор-связывающий домен (RBD), который отвечает за распознавание и связывание с рецептором клеточной поверхности. Некоторые авторы показали, что оптимизированный ИФА против шиповидного S-белка SARS-CoV-2 является чувствительным и специфичным (Freeman et al. 2020).

 

Нормативный статус: RUO (Research Use Only — только для научных исследований, не для медицины)

Тип: рекомбинантный белок

Источник: E.coli

Чистота: более 95,0% по данным ВЭЖХ

Транспортировка и хранение: при температуре не выше 10°С

Фасовка: 0,1 мг, 0,5 мг, 1 мг (сухая субстанция, лиофилизированная)

 

 

АНАЛИТИЧЕСКИЙ ПАСПОРТ

Рекомбинантного белка RPSSARSCOV2-264-680aa AURON ARTscience

 

Аминокислотная последовательность:

MGSSHHHHHHSSGLVPRGSHMayyvgylqprtfllkynengtitdavdcaldplsetkctlksftvekgiyqtsnfrvqptesivrfpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvlsfellhapatvcgpkkstnlvknkcvnfnfngltgtgvltesnkkflpfqqfgrdiadttdavrdpqtleilditpcsfggvsvitpgtntsnqvavlyqdvnctevpvaihadqltptwrvystgsnvfqtragcligaehvnnsyecdipigagicasyqtqtns

 

 

Наименование продукта: Рекомбинантный белок RPSSARSCOV2-264-680aa
Способ получения: Прокариотическая экспрессия гена
Условное обозначение: RPSSARSCOV2-264-680aa
Категория продукта: реактив
Молекулярная масса, Да 48480.05
Количество продукта 6 мг
Внешний вид: Сухая субстанция (лиофилизированная)
Условия хранения: Хранить при температуре не выше 10°С

 

 

Электрофоретический анализ RPS-SARSCOV2-264-680aa проводили в 15% ПААГ в денатурирующих условиях.

РЕЗУЛЬТАТЫ АНАЛИЗОВ

 

Наименование анализа Метод Требования Результаты Соответствие
Электрофоретическая чистота Белковый электрофорез >80% 85% Соответствует
Молекулярная масса, Да Белковый электрофорез 48480.05 48480.05 Соответствует