SARS-CoV-2 рекомбинантный белок RPN-SARSCOV2-321-422aa, AURON ARTscience

 
 

Цена по запросу

SARS-CoV-2 (2019-nCoV) 321-422aa фрагмент белка нуклеокапсида (N), рекомбинант E.coli, с присоединенной  His-меткой на N-конце.

N-белок представляет собой предсказанный фосфо-белок массой 46 кДа, состоящий из 423 аминокислот, который имеет небольшую гомологию с другими представителями рода Coronavirus (Timani et al., 2004; Surjit et al., 2004). Несколько исследований показали, что белок N является высокоиммуногенным, поэтому ответ антител у пациентов с ОРВИ направлен наиболее часто и преимущественно на нуклеокапсид. Также было обнаружено, что анти-N-антитела обнаруживаются на ранней стадии и имеют высокую специфичность во время инфекции (Leung et al., 2004). Использование 321-422аа фрагмента белка нуклеокапсида в ELISE обеспечивает более специфический сигнал (Chen et al.2004, Wang et al., 2012).

Описание

SARS-CoV-2 recombinant proteins / SARS-CoV-2 рекомбинантные белки

Оценка количества антител в плазме крови дополняет РНК-тесты и улучшает понимание течения заболевания.  Разработаны тесты, выявляющие антитела к белку нуклеокапсида вируса (N) и/или к спайк-белку (S), на основе иммуноферментного анализа (ИФА), иммунофлуоресценции, иммунохроматографического анализа.

Нейтрализующие антитела, нацеленные на спайк-белки (S) и нуклеокапсид (N) нового коронавируса SARS-CoV-2, образуются уже на 9-й день после инфицирования.  Показано, что у людей с ослабленным иммунитетом антитела на оба белка появлялись в детектируемых количествах позже.

 

RPN-SARSCOV2-321-422aa  AURON ARTscience

SARS-CoV-2 (2019-nCoV) 321-422aa fragment of Nucleocapsid Protein, E.coli Recombinant, fused to His tag at N-terminal

 

The N protein is a 423 amino acid, predicted phospho-protein of 46 kDa, which shares little homology with other members of the Coronavirus genus (Timani et al., 2004; Surjit et al., 2004). Several studies have found that N protein is highly immunogenic, thus antibody response in patients with SARS is directed most frequently and predominantly to the nucleocapsid. It has also been found that anti N antibodies are detected early and with high specificity during infection (Leung et al., 2004). Usage of 321-422aa fragment of Nucleocapsid Protein in ELISE provides more specific signal (Chen et al.2004, Wang et al., 2012).

 

Protein N 321-422aa sequence:

MGSSHHHHHHSSGLVPRGSHMIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

 

Regulatory status: RUO (Research Use Only)

Type: Recombinant protein

Source: E. coli

Purity: Greater than 95.0% as determined by HPLC

Form: Dry (lyophilized)

Size: 0.1 mg, 0.5 mg, 1 mg

 

REFERENCES:

Chen Z, et al. Antigenicity analysis of different regions of the severe acute respiratory syndrome coronavirus nucleocapsid protein. Clin Chem. 2004. PMID: 15054081

Hui-Juan Wang, Wei-Min Zhou, Lin-Ling Zhang, Li Ruan, Ning-Shao Xia, Wen-Jie Tan Antigenicity Characterization of Six Different Fragments of SARS-CoV N Protein Expressed in E. Coli. Zhonghua Shi Yan He Lin Chuang Bing Du Xue Za Zhi 2012 Feb;26(1):40-2.

Leung DT, Tam FC, Ma CH, Chan PK, Cheung JL, Niu H, Tam JS, Lim PL: Antibody response of patients with severe acute respiratory syndrome (SARS) targets the viral nucleocapsid. J Infect Dis. 2004, 190: 379-386. 10.1086/422040.

Surjit M, Liu B, Kumar P, Chow VT, Lal SK: The nucleocapsid protein of the SARS coronavirus is capable of self-association through a C-terminal 209 amino acid interaction domain. Biochem Biophys Res Commun. 2004, 317: 1030-1036. 10.1016/j.bbrc.2004.03.154.

Timani KA, Ye L, Ye L, Zhu Y, Wu Z, Gong Z: Cloning, sequencing, expression, and purification of SARS-associated coronavirus nucleocapsid protein for serodiagnosis of SARS. J Clin Virol. 2004, 30: 309-312. 10.1016/j.jcv.2004.01.001.

 

 

SARS-CoV-2 (2019-nCoV) 321-422aa фрагмент белка нуклеокапсида (N), рекомбинант E.coli, с присоединенной  His-меткой на N-конце.

 

N-белок представляет собой предсказанный фосфо-белок массой 46 кДа, состоящий из 423 аминокислот, который имеет небольшую гомологию с другими представителями рода Coronavirus (Timani et al., 2004; Surjit et al., 2004). Несколько исследований показали, что белок N является высокоиммуногенным, поэтому ответ антител у пациентов с ОРВИ направлен наиболее часто и преимущественно на нуклеокапсид. Также было обнаружено, что анти-N-антитела обнаруживаются на ранней стадии и имеют высокую специфичность во время инфекции (Leung et al., 2004). Использование 321-422аа фрагмента белка нуклеокапсида в ELISE обеспечивает более специфический сигнал (Chen et al.2004, Wang et al., 2012).

 

Нормативный статус: RUO (Research Use Only — только для научных исследований, не для медицины)

Тип: рекомбинантный белок

Источник: E.coli

Чистота: более 95,0% по данным ВЭЖХ

Хранение и транспортировка: при температуре не выше 10°С

Фасовка: 0,1 мг, 0,5 мг, 1 мг (сухая субстанция, лиофилизированная)

 

 

АНАЛИТИЧЕСКИЙ ПАСПОРТ

Рекомбинантного белка RPNSARSCOV2-321-422aa AURON ARTscience

 

Аминокислотная последовательность:

MGSSHHHHHHSSGLVPRGSHMigmevtpsgtwltytgaiklddkdpnfkdqvillnkhidayktfpptepkkdkkkkadetqalpqrqkkqqtvtllpaadlddfskqlqqsmssadstqa

 

 

Наименование продукта: Рекомбинантный белок RPNSARSCOV2-321-422aa
Способ получения: Прокариотическая экспрессия гена
Условное обозначение: RPNSARSCOV2-321-422aa
Категория продукта: реактив
Молекулярная масса, Да 13501.1
Количество продукта 20 мг
Внешний вид: Сухая субстанция (лиофилизированная)
Условия хранения: Хранить при температуре не выше 10°С

 

Хроматографический анализ проводили на колонке VDSpher PUR 100 C18-E 250×4,6 mm в градиенте концентрации 80% AcCN в 0,1% ТФУ от 30 до 70% со скоростью 1 мл/мин.

Электрофоретический анализ RPN-SARSCOV2-321-422aa проводили в 15% ПААГ в денатурирующих условиях. 

 

РЕЗУЛЬТАТЫ АНАЛИЗОВ

 

Наименование анализа Метод Требования Результаты Соответствие
Хроматографическая чистота ОФ-ВЭЖХ >95% 98,4% Соответствует
Молекулярная масса, Да Белковый электрофорез 13501.1 13501.1 Соответствует